PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28040.m000035
Common NameRCOM_0148890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 103aa    MW: 12412.2 Da    PI: 10.3365
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28040.m000035genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054.1e-332684159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   ldDgy+WrKYGqK+vk++ +prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  28040.m000035 26 LDDGYKWRKYGQKVVKNTLHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 84
                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-341184IPR003657WRKY domain
SuperFamilySSF1182901.31E-291885IPR003657WRKY domain
PROSITE profilePS5081129.3562186IPR003657WRKY domain
SMARTSM007742.2E-372685IPR003657WRKY domain
PfamPF031063.2E-262783IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MKKIKARRKV REPRFCFKTM SDVDVLDDGY KWRKYGQKVV KNTLHPRSYY RCTQDNCRVK  60
KRVERLAEDP RMVITTYEGR HAHSPSHDLE DSQAQSQLNN FFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-281783874Probable WRKY transcription factor 4
1wj2_A1e-281783874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534045.21e-73PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB75e-57WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLB9T7267e-74B9T726_RICCO; WRKY transcription factor, putative (Fragment)
TrEMBLS5CK934e-73S5CK93_JATCU; Uncharacterized protein
STRINGPOPTR_0007s06930.14e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.13e-58WRKY DNA-binding protein 13